Lineage for d2zl9a_ (2zl9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009359Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2009387Species Norway rat (Rattus norvegicus) [TaxId:10116] [101432] (15 PDB entries)
  8. 2009393Domain d2zl9a_: 2zl9 A: [154626]
    automated match to d1rkha_
    protein/DNA complex; complexed with vda

Details for d2zl9a_

PDB Entry: 2zl9 (more details), 1.9 Å

PDB Description: 2-Substituted-16-ene-22-thia-1alpha,25-dihydroxy-26,27-dimethyl-19-norvitamin D3 analogs: Synthesis, biological evaluation and crystal structure
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d2zl9a_:

Sequence, based on SEQRES records: (download)

>d2zl9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrmdgstgsvtldlsplsmlphladl
vsysiqkvigfakmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdy
kydvtdvskaghtlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklve
aiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmk
ltplvlevfg

Sequence, based on observed residues (ATOM records): (download)

>d2zl9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrmplsmlphladlvsysiqkvigfa
kmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskagh
tlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlqt
yircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfg

SCOPe Domain Coordinates for d2zl9a_:

Click to download the PDB-style file with coordinates for d2zl9a_.
(The format of our PDB-style files is described here.)

Timeline for d2zl9a_: