![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) ![]() |
![]() | Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
![]() | Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
![]() | Species Arthrobacter globiformis [TaxId:1665] [54421] (41 PDB entries) Uniprot P46881 9-628 |
![]() | Domain d2zl8b2: 2zl8 B:9-96 [154624] Other proteins in same PDB: d2zl8a1, d2zl8b1 automated match to d1ivwa2 complexed with cu |
PDB Entry: 2zl8 (more details), 1.73 Å
SCOPe Domain Sequences for d2zl8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zl8b2 d.17.2.1 (B:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]} aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs garpqevtvsvtngtvisaveldtaatg
Timeline for d2zl8b2: