| Class i: Low resolution protein structures [58117] (26 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
| Protein 70S ribosome functional complex [58121] (9 species) |
| Species Canis lupus familiaris [TaxId:9615] [161275] (2 PDB entries) |
| Domain d2zkrz1: 2zkr z:12-81 [154618] Other proteins in same PDB: d2zkrv1 automatically matched to d1s1i9_ |
PDB Entry: 2zkr (more details), 8.7 Å
SCOP Domain Sequences for d2zkrz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zkrz1 i.1.1.1 (z:12-81) 70S ribosome functional complex {Canis lupus familiaris [TaxId: 9615]}
gkygtrygaslrkmvkkieisqhakytcsfcgktkmkrravgiwhcgscmktvaggawty
nttsavtvks
Timeline for d2zkrz1: