Lineage for d2zkr41 (2zkr 4:2-92)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1248420Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1248421Protein 70S ribosome functional complex [58121] (9 species)
  7. 1248467Species Canis lupus familiaris [TaxId:9615] [161275] (2 PDB entries)
  8. 1248478Domain d2zkr41: 2zkr 4:2-92 [154603]
    Other proteins in same PDB: d2zkrv1
    automatically matched to d1s1iz_
    protein/RNA complex

Details for d2zkr41

PDB Entry: 2zkr (more details), 8.7 Å

PDB Description: Structure of a mammalian Ribosomal 60S subunit within an 80S complex obtained by docking homology models of the RNA and proteins into an 8.7 A cryo-EM map
PDB Compounds: (4:) 60S Ribosomal protein L44e

SCOPe Domain Sequences for d2zkr41:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkr41 i.1.1.1 (4:2-92) 70S ribosome functional complex {Canis lupus familiaris [TaxId: 9615]}
vnvpktrrtfckkcgkhqphkvtqykkgkdslyaqgkrrydrkqsgyggqtkpifrkkak
ttkkivlrlecvepncrskrmlaikrckhfe

SCOPe Domain Coordinates for d2zkr41:

Click to download the PDB-style file with coordinates for d2zkr41.
(The format of our PDB-style files is described here.)

Timeline for d2zkr41: