SCOPe 2.02: Domain d2zkr21: 2zkr 2:3-53

Lineage for d2zkr21 (2zkr 2:3-53)

1. Root: SCOPe 2.02

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Canis lupus familiaris [TaxId:9615] [161275] (2 PDB entries)

8. Domain d2zkr21: 2zkr 2:3-53 [154602]
   Other proteins in same PDB: d2zkrv1
   automatically matched to d1s1iy_
   protein/RNA complex

Details for d2zkr21

PDB Entry: 2zkr, 8.7 Å

PDB Description: Structure of a mammalian Ribosomal 60S subunit within an 80S complex obtained by docking homology models of the RNA and proteins into an 8.7 A cryo-EM map

PDB Compounds: (2:) 60S Ribosomal protein L37e

SCOPe Domain Sequences for d2zkr21:

Sequence; same for both SEQRES and ATOM records:

>d2zkr21 i.1.1.1 (2:3-53) 70S ribosome functional complex {Canis lupus familiaris [TaxId: 9615]}
kgtssfgkrrnkthtlcrrcgskayhlqkstcgkcgypakrkrkynwsaka

Timeline for d2zkr21:

• d2zkr21 first appeared in SCOP 1.75
  
• d2zkr21 appears in SCOPe 2.01
  
• d2zkr21 appears in SCOPe 2.03
  
• d2zkr21 appears in the current release, SCOPe 2.08