Lineage for d2zkr21 (2zkr 2:3-53)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896372Species Canis lupus familiaris [TaxId:9615] [161275] (2 PDB entries)
  8. 896382Domain d2zkr21: 2zkr 2:3-53 [154602]
    Other proteins in same PDB: d2zkrv1
    automatically matched to d1s1iy_

Details for d2zkr21

PDB Entry: 2zkr (more details), 8.7 Å

PDB Description: Structure of a mammalian Ribosomal 60S subunit within an 80S complex obtained by docking homology models of the RNA and proteins into an 8.7 A cryo-EM map
PDB Compounds: (2:) 60S Ribosomal protein L37e

SCOP Domain Sequences for d2zkr21:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkr21 i.1.1.1 (2:3-53) 70S ribosome functional complex {Canis lupus familiaris [TaxId: 9615]}
kgtssfgkrrnkthtlcrrcgskayhlqkstcgkcgypakrkrkynwsaka

SCOP Domain Coordinates for d2zkr21:

Click to download the PDB-style file with coordinates for d2zkr21.
(The format of our PDB-style files is described here.)

Timeline for d2zkr21: