![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
![]() | Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species) |
![]() | Species Dog (Canis familiaris) [TaxId:9615] [267690] (2 PDB entries) |
![]() | Domain d2zkqo1: 2zkq o:1-85 [154600] Other proteins in same PDB: d2zkqc1 protein/RNA complex protein/RNA complex |
PDB Entry: 2zkq (more details), 8.7 Å
SCOPe Domain Sequences for d2zkqo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zkqo1 i.1.1.1 (o:1-85) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Dog (Canis familiaris) [TaxId: 9615]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklg
Timeline for d2zkqo1: