Lineage for d2zkqk1 (2zkq k:23-147)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1970700Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 1971481Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species)
  7. 1971527Species Dog (Canis familiaris) [TaxId:9615] [267690] (2 PDB entries)
  8. 1971532Domain d2zkqk1: 2zkq k:23-147 [154596]
    Other proteins in same PDB: d2zkqc1
    protein/RNA complex
    protein/RNA complex

Details for d2zkqk1

PDB Entry: 2zkq (more details), 8.7 Å

PDB Description: Structure of a mammalian Ribosomal 40S subunit within an 80S complex obtained by docking homology models of the RNA and proteins into an 8.7 A cryo-EM map
PDB Compounds: (k:) 40S Ribosomal protein S14e

SCOPe Domain Sequences for d2zkqk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkqk1 i.1.1.1 (k:23-147) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Dog (Canis familiaris) [TaxId: 9615]}
egenvfgvchifasfndtfvhvtdlsgketicrvtggmkvkadrdesspyaamlaaqdva
qrckelgitalhiklratggnrtktpgpgaqsalralarsgmkigriedvtpipsdstrr
kggrr

SCOPe Domain Coordinates for d2zkqk1:

Click to download the PDB-style file with coordinates for d2zkqk1.
(The format of our PDB-style files is described here.)

Timeline for d2zkqk1: