Lineage for d2zkqk1 (2zkq k:23-147)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. Species Dog (Canis familiaris) [TaxId:9615] [161275] (2 PDB entries)
  8. 1710405Domain d2zkqk1: 2zkq k:23-147 [154596]
    Other proteins in same PDB: d2zkqc1
    automatically matched to d1s1hk_
    protein/RNA complex

Details for d2zkqk1

PDB Entry: 2zkq (more details), 8.7 Å

PDB Description: Structure of a mammalian Ribosomal 40S subunit within an 80S complex obtained by docking homology models of the RNA and proteins into an 8.7 A cryo-EM map
PDB Compounds: (k:) 40S Ribosomal protein S14e

SCOPe Domain Sequences for d2zkqk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkqk1 i.1.1.1 (k:23-147) 70S ribosome functional complex {Dog (Canis familiaris) [TaxId: 9615]}
egenvfgvchifasfndtfvhvtdlsgketicrvtggmkvkadrdesspyaamlaaqdva
qrckelgitalhiklratggnrtktpgpgaqsalralarsgmkigriedvtpipsdstrr
kggrr

SCOPe Domain Coordinates for d2zkqk1:

Click to download the PDB-style file with coordinates for d2zkqk1.
(The format of our PDB-style files is described here.)

Timeline for d2zkqk1: