Lineage for d2zkqc1 (2zkq c:17-95)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947289Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947290Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 2947306Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)
  7. 2947307Species Dog (Canis familiaris) [TaxId:9615] [160237] (1 PDB entry)
  8. 2947308Domain d2zkqc1: 2zkq c:17-95 [154591]
    Other proteins in same PDB: d2zkqe1, d2zkqh1, d2zkqi1, d2zkqj1, d2zkqk1, d2zkql1, d2zkqm1, d2zkqn1, d2zkqo1, d2zkqs1
    protein/RNA complex
    protein/RNA complex

Details for d2zkqc1

PDB Entry: 2zkq (more details), 8.7 Å

PDB Description: Structure of a mammalian Ribosomal 40S subunit within an 80S complex obtained by docking homology models of the RNA and proteins into an 8.7 A cryo-EM map
PDB Compounds: (c:) 40S Ribosomal protein S3e

SCOPe Domain Sequences for d2zkqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkqc1 d.52.3.1 (c:17-95) Ribosomal protein S3 N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]}
fkaelnefltrelaedgysgvevrvtptrteiiilatrtqnvlgekgrrireltavvqkr
fgfpegsvelyaekvatrg

SCOPe Domain Coordinates for d2zkqc1:

Click to download the PDB-style file with coordinates for d2zkqc1.
(The format of our PDB-style files is described here.)

Timeline for d2zkqc1: