Lineage for d2zkmx4 (2zkm X:312-660)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089342Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2089343Family c.1.18.1: Mammalian PLC [51696] (2 protein domains)
  6. 2089367Protein Phospholipase C-beta-2 [159421] (1 species)
  7. 2089368Species Human (Homo sapiens) [TaxId:9606] [159422] (2 PDB entries)
    Uniprot Q00722 312-660
  8. 2089369Domain d2zkmx4: 2zkm X:312-660 [154590]
    Other proteins in same PDB: d2zkmx1, d2zkmx2, d2zkmx3
    automatically matched to 2FJU B:312-660
    complexed with ca

Details for d2zkmx4

PDB Entry: 2zkm (more details), 1.62 Å

PDB Description: crystal structure of phospholipase c beta 2
PDB Compounds: (X:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2

SCOPe Domain Sequences for d2zkmx4:

Sequence, based on SEQRES records: (download)

>d2zkmx4 c.1.18.1 (X:312-660) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
hdmtqplnhyfinsshntyltagqfsglssaemyrqvllsgcrcveldcwkgkppdeepi
ithgftmttdiffkeaieaiaesafktspypiilsfenhvdsprqqakmaeycrtifgdm
llteplekfplkpgvplpspedlrgkiliknkknqfsgptssskdtggeaegssppsapa
vwageegteleeeeveeeeeeesgnldeeeikkmqsdegtaglevtayeemsslvnyiqp
tkfvsfefsaqknrsyvissftelkaydllskasvqfvdynkrqmsriypkgtrmdssny
mpqmfwnagcqmvalnfqtmdlpmqqnmavfefngqsgyllkhefmrrp

Sequence, based on observed residues (ATOM records): (download)

>d2zkmx4 c.1.18.1 (X:312-660) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
hdmtqplnhyfinsshntyltagqfsglssaemyrqvllsgcrcveldcwkgkppdeepi
ithgftmttdiffkeaieaiaesafktspypiilsfenhvdsprqqakmaeycrtifgdm
llteplekfplkpgvplpspedlrgkiliknkknnldeeeikkmqsdegtaglevtayee
msslvnyiqptkfvsfefsaqknrsyvissftelkaydllskasvqfvdynkrqmsriyp
kgtrmdssnympqmfwnagcqmvalnfqtmdlpmqqnmavfefngqsgyllkhefmrrp

SCOPe Domain Coordinates for d2zkmx4:

Click to download the PDB-style file with coordinates for d2zkmx4.
(The format of our PDB-style files is described here.)

Timeline for d2zkmx4: