Lineage for d2zkmx3 (2zkm X:11-141)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957214Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 957215Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 957216Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 957344Protein Phospholipase C-beta-2 [159207] (1 species)
  7. 957345Species Human (Homo sapiens) [TaxId:9606] [159208] (2 PDB entries)
    Uniprot Q00722 11-141
  8. 957346Domain d2zkmx3: 2zkm X:11-141 [154589]
    Other proteins in same PDB: d2zkmx1, d2zkmx2, d2zkmx4
    automatically matched to 2FJU B:11-141
    complexed with ca

Details for d2zkmx3

PDB Entry: 2zkm (more details), 1.62 Å

PDB Description: crystal structure of phospholipase c beta 2
PDB Compounds: (X:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2

SCOPe Domain Sequences for d2zkmx3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
pkvkaylsqgerfikwddettvaspvilrvdpkgyylywtyqskemeflditsirdtrfg
kfakmpksqklrdvfnmdfpdnsfllktltvvsgpdmvdltfhnfvsykenvgkawaedv
lalvkhpltan

SCOPe Domain Coordinates for d2zkmx3:

Click to download the PDB-style file with coordinates for d2zkmx3.
(The format of our PDB-style files is described here.)

Timeline for d2zkmx3: