SCOPe 2.05: Domain d2zkmx2: 2zkm X:678-799

Lineage for d2zkmx2 (2zkm X:678-799)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)

6. Protein Phospholipase C-beta-2 [158944] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158945] (2 PDB entries)
   Uniprot Q00722 678-799

8. Domain d2zkmx2: 2zkm X:678-799 [154588]
   Other proteins in same PDB: d2zkmx1, d2zkmx3, d2zkmx4
   automatically matched to 2FJU B:678-799
   complexed with ca

Details for d2zkmx2

PDB Entry: 2zkm, 1.62 Å

PDB Description: crystal structure of phospholipase c beta 2

PDB Compounds: (X:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2

SCOPe Domain Sequences for d2zkmx2:

Sequence; same for both SEQRES and ATOM records:

>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
ttlsitvisgqflsersvrtyvevelfglpgdpkrryrtklspstnsinpvwkeepfvfe
kilmpelaslrvavmeegnkflghriipinalnsgyhhlclhsesnmpltmpalfiflem
kd

Timeline for d2zkmx2:

• d2zkmx2 first appeared in SCOP 1.75
  
• d2zkmx2 appears in SCOPe 2.04
  
• d2zkmx2 appears in SCOPe 2.06
  
• d2zkmx2 appears in the current release, SCOPe 2.08