![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
![]() | Protein Phospholipase C-beta-2 [158944] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158945] (2 PDB entries) Uniprot Q00722 678-799 |
![]() | Domain d2zkmx2: 2zkm X:678-799 [154588] Other proteins in same PDB: d2zkmx1, d2zkmx3, d2zkmx4 automatically matched to 2FJU B:678-799 complexed with ca |
PDB Entry: 2zkm (more details), 1.62 Å
SCOPe Domain Sequences for d2zkmx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} ttlsitvisgqflsersvrtyvevelfglpgdpkrryrtklspstnsinpvwkeepfvfe kilmpelaslrvavmeegnkflghriipinalnsgyhhlclhsesnmpltmpalfiflem kd
Timeline for d2zkmx2: