Lineage for d2zkmx2 (2zkm X:678-799)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772796Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2772898Protein Phospholipase C-beta-2 [158944] (1 species)
  7. 2772899Species Human (Homo sapiens) [TaxId:9606] [158945] (2 PDB entries)
    Uniprot Q00722 678-799
  8. 2772900Domain d2zkmx2: 2zkm X:678-799 [154588]
    Other proteins in same PDB: d2zkmx1, d2zkmx3, d2zkmx4
    automatically matched to 2FJU B:678-799
    complexed with ca

Details for d2zkmx2

PDB Entry: 2zkm (more details), 1.62 Å

PDB Description: crystal structure of phospholipase c beta 2
PDB Compounds: (X:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2

SCOPe Domain Sequences for d2zkmx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
ttlsitvisgqflsersvrtyvevelfglpgdpkrryrtklspstnsinpvwkeepfvfe
kilmpelaslrvavmeegnkflghriipinalnsgyhhlclhsesnmpltmpalfiflem
kd

SCOPe Domain Coordinates for d2zkmx2:

Click to download the PDB-style file with coordinates for d2zkmx2.
(The format of our PDB-style files is described here.)

Timeline for d2zkmx2: