Lineage for d2zkmx1 (2zkm X:142-311)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 769152Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 769212Protein Phospholipase C-beta-2 [158478] (1 species)
  7. 769213Species Human (Homo sapiens) [TaxId:9606] [158479] (2 PDB entries)
    Uniprot Q00722 142-311
  8. 769214Domain d2zkmx1: 2zkm X:142-311 [154587]
    Other proteins in same PDB: d2zkmx2, d2zkmx3, d2zkmx4
    automatically matched to 2FJU B:142-311
    complexed with ca

Details for d2zkmx1

PDB Entry: 2zkm (more details), 1.62 Å

PDB Description: crystal structure of phospholipase c beta 2
PDB Compounds: (X:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2

SCOP Domain Sequences for d2zkmx1:

Sequence, based on SEQRES records: (download)

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
asrstfldkilvklkmqlnsegkipvknffqmfpadrkrveaalsachlpkgkndainpe
dfpepvyksflmslcprpeideiftsyhakakpymtkehltkfinqkqrdsrlnsllfpp
arpdqvqglidkyepsginaqrgqlspegmvwflcgpensvlaqdklllh

Sequence, based on observed residues (ATOM records): (download)

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
asrstfldkilvklkmqlnsegkipvknffqmfpadrkrveaalsachlpkgkndainpe
dfpepvyksflmslcprpeideiftymtkehltkfinqkqrqvqglidkyepslspegmv
wflcgpensvlaqdklllh

SCOP Domain Coordinates for d2zkmx1:

Click to download the PDB-style file with coordinates for d2zkmx1.
(The format of our PDB-style files is described here.)

Timeline for d2zkmx1: