Lineage for d2zkmx1 (2zkm X:142-311)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1995442Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 protein domains)
  6. 1995501Protein Phospholipase C-beta-2 [158478] (1 species)
  7. 1995502Species Human (Homo sapiens) [TaxId:9606] [158479] (2 PDB entries)
    Uniprot Q00722 142-311
  8. 1995503Domain d2zkmx1: 2zkm X:142-311 [154587]
    Other proteins in same PDB: d2zkmx2, d2zkmx3, d2zkmx4
    automatically matched to 2FJU B:142-311
    complexed with ca

Details for d2zkmx1

PDB Entry: 2zkm (more details), 1.62 Å

PDB Description: crystal structure of phospholipase c beta 2
PDB Compounds: (X:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2

SCOPe Domain Sequences for d2zkmx1:

Sequence, based on SEQRES records: (download)

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
asrstfldkilvklkmqlnsegkipvknffqmfpadrkrveaalsachlpkgkndainpe
dfpepvyksflmslcprpeideiftsyhakakpymtkehltkfinqkqrdsrlnsllfpp
arpdqvqglidkyepsginaqrgqlspegmvwflcgpensvlaqdklllh

Sequence, based on observed residues (ATOM records): (download)

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
asrstfldkilvklkmqlnsegkipvknffqmfpadrkrveaalsachlpkgkndainpe
dfpepvyksflmslcprpeideiftymtkehltkfinqkqrqvqglidkyepslspegmv
wflcgpensvlaqdklllh

SCOPe Domain Coordinates for d2zkmx1:

Click to download the PDB-style file with coordinates for d2zkmx1.
(The format of our PDB-style files is described here.)

Timeline for d2zkmx1: