Lineage for d2zkdb1 (2zkd B:405-612)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813146Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 813147Superfamily b.122.1: PUA domain-like [88697] (13 families) (S)
  5. 813337Family b.122.1.12: SRA domain-like [159368] (1 protein)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 813338Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)
  7. 813347Species Mouse (Mus musculus) [TaxId:10090] [159371] (6 PDB entries)
    Uniprot Q8VDF2 405-613! Uniprot Q8VDF2 418-625
  8. 813349Domain d2zkdb1: 2zkd B:405-612 [154584]
    automatically matched to 2ZKD A:405-613
    complexed with 5cm, act, edo

Details for d2zkdb1

PDB Entry: 2zkd (more details), 1.6 Å

PDB Description: crystal structure of the sra domain of mouse np95 in complex with hemi-methylated cpg dna
PDB Compounds: (B:) E3 ubiquitin-protein ligase UHRF1

SCOP Domain Sequences for d2zkdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkdb1 b.122.1.12 (B:405-612) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]}
gmacvgrttectivpanhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgays
lvlaggyeddvdngnyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspinek
gaeaedwrqgkpvrvvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryll
rrddtepepwtregkdrtrqlgltmqyp

SCOP Domain Coordinates for d2zkdb1:

Click to download the PDB-style file with coordinates for d2zkdb1.
(The format of our PDB-style files is described here.)

Timeline for d2zkdb1: