Lineage for d2zkba2 (2zkb A:137-295)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 868802Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 868803Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 869038Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein)
  6. 869039Protein Urate oxidase (uricase) [55634] (3 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. 869137Species Aspergillus flavus [TaxId:5059] [55635] (22 PDB entries)
  8. 869149Domain d2zkba2: 2zkb A:137-295 [154582]
    automatically matched to d1r56c2
    complexed with ace, aza, na, oxy

Details for d2zkba2

PDB Entry: 2zkb (more details), 1.61 Å

PDB Description: Urate oxidase complexed with 8-azaxanthine under 2.5 MPa oxygen pressure
PDB Compounds: (A:) Uricase

SCOP Domain Sequences for d2zkba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkba2 d.96.1.4 (A:137-295) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrs

SCOP Domain Coordinates for d2zkba2:

Click to download the PDB-style file with coordinates for d2zkba2.
(The format of our PDB-style files is described here.)

Timeline for d2zkba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zkba1