Lineage for d2zkaa1 (2zka A:1-136)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035940Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1035941Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 1036181Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein)
  6. 1036182Protein Urate oxidase (uricase) [55634] (3 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. 1036280Species Aspergillus flavus [TaxId:5059] [55635] (22 PDB entries)
  8. 1036285Domain d2zkaa1: 2zka A:1-136 [154579]
    automatically matched to d1r4sa1
    complexed with aza, na, oxy

Details for d2zkaa1

PDB Entry: 2zka (more details), 1.61 Å

PDB Description: Urate oxidase complexed with 8-azaxanthine under 1.0 MPa oxygen pressure
PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d2zkaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkaa1 d.96.1.4 (A:1-136) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
irdseekrnvqvdvve

SCOPe Domain Coordinates for d2zkaa1:

Click to download the PDB-style file with coordinates for d2zkaa1.
(The format of our PDB-style files is described here.)

Timeline for d2zkaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zkaa2