![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
![]() | Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
![]() | Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins) automatically mapped to Pfam PF01014 |
![]() | Protein Urate oxidase (uricase) [55634] (3 species) duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16 |
![]() | Species Aspergillus flavus [TaxId:5059] [55635] (71 PDB entries) |
![]() | Domain d2zkaa1: 2zka A:1-136 [154579] automated match to d1r4ua1 complexed with aza, na, oxy |
PDB Entry: 2zka (more details), 1.61 Å
SCOPe Domain Sequences for d2zkaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zkaa1 d.96.1.4 (A:1-136) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]} savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf irdseekrnvqvdvve
Timeline for d2zkaa1: