Lineage for d2zjrz1 (2zjr Z:2-59)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066475Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1066627Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 1066628Protein Ribosomal protein L32p [144201] (3 species)
  7. 1066629Species Deinococcus radiodurans [TaxId:1299] [161178] (10 PDB entries)
    Uniprot P49228 2-59
  8. 1066630Domain d2zjrz1: 2zjr Z:2-59 [154577]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1
    Representative structure
    complexed with mg

Details for d2zjrz1

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (Z:) 50S ribosomal protein L32

SCOPe Domain Sequences for d2zjrz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjrz1 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOPe Domain Coordinates for d2zjrz1:

Click to download the PDB-style file with coordinates for d2zjrz1.
(The format of our PDB-style files is described here.)

Timeline for d2zjrz1: