Lineage for d2zjrv1 (2zjr V:1-66)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476004Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1476030Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 1476031Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 1476032Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 1476033Species Deinococcus radiodurans [TaxId:1299] [158220] (8 PDB entries)
    Uniprot Q9RXJ4 1-66
  8. 1476034Domain d2zjrv1: 2zjr V:1-66 [154575]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjrv1

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (V:) 50S ribosomal protein L29

SCOPe Domain Sequences for d2zjrv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjrv1 a.2.2.1 (V:1-66) Ribosomal protein L29 (L29p) {Deinococcus radiodurans [TaxId: 1299]}
mkpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkael
arkgeq

SCOPe Domain Coordinates for d2zjrv1:

Click to download the PDB-style file with coordinates for d2zjrv1.
(The format of our PDB-style files is described here.)

Timeline for d2zjrv1: