SCOPe 2.07: Domain d2zjrt1: 2zjr T:2-85

Lineage for d2zjrt1 (2zjr T:2-85)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families)
   rudiment single hybrid fold with a permuted topology

5. Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
   Pfam PF01016

6. Protein Ribosomal protein L27 [110326] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159323] (7 PDB entries)
   Uniprot Q9RY65 2-85

8. Domain d2zjrt1: 2zjr T:2-85 [154573]
   Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
   Representative structure
   complexed with mg

Details for d2zjrt1

PDB Entry: 2zjr, 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans

PDB Compounds: (T:) 50S ribosomal protein L27

SCOPe Domain Sequences for d2zjrt1:

Sequence; same for both SEQRES and ATOM records:

>d2zjrt1 b.84.4.1 (T:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaq

Timeline for d2zjrt1:

• d2zjrt1 first appeared in SCOP 1.75
  
• d2zjrt1 appears in SCOPe 2.06
  
• d2zjrt1 appears in the current release, SCOPe 2.08