Class b: All beta proteins [48724] (177 folds) |
Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) |
Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins) |
Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species) contains additional all-beta (sub)domain in the C-terminal extension |
Species Deinococcus radiodurans [TaxId:1299] [159200] (6 PDB entries) Uniprot Q9RX88 1-175 |
Domain d2zjrs1: 2zjr S:1-175 [154572] Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1 Representative structure complexed with mg |
PDB Entry: 2zjr (more details), 2.91 Å
SCOPe Domain Sequences for d2zjrs1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjrs1 b.53.1.1 (S:1-175) Ribosomal protein TL5 (general stress protein CTC) {Deinococcus radiodurans [TaxId: 1299]} meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlppr
Timeline for d2zjrs1:
View in 3D Domains from other chains: (mouse over for more information) d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1 |