Lineage for d2zjrs1 (2zjr S:1-175)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070856Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2070857Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2070858Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 2070893Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 2070894Species Deinococcus radiodurans [TaxId:1299] [159200] (6 PDB entries)
    Uniprot Q9RX88 1-175
  8. 2070895Domain d2zjrs1: 2zjr S:1-175 [154572]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjrs1

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (S:) 50S ribosomal protein L25

SCOPe Domain Sequences for d2zjrs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjrs1 b.53.1.1 (S:1-175) Ribosomal protein TL5 (general stress protein CTC) {Deinococcus radiodurans [TaxId: 1299]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlppr

SCOPe Domain Coordinates for d2zjrs1:

Click to download the PDB-style file with coordinates for d2zjrs1.
(The format of our PDB-style files is described here.)

Timeline for d2zjrs1: