SCOPe 2.07: Domain d2zjrr1: 2zjr R:4-113

Lineage for d2zjrr1 (2zjr R:4-113)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159024] (7 PDB entries)
   Uniprot Q9RXJ1 4-113

8. Domain d2zjrr1: 2zjr R:4-113 [154571]
   Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
   Representative structure
   complexed with mg

Details for d2zjrr1

PDB Entry: 2zjr, 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans

PDB Compounds: (R:) 50S ribosomal protein L24

SCOPe Domain Sequences for d2zjrr1:

Sequence; same for both SEQRES and ATOM records:

>d2zjrr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]}
psagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkpsmt
npqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkt

Timeline for d2zjrr1:

• d2zjrr1 first appeared in SCOP 1.75
  
• d2zjrr1 appears in SCOPe 2.06
  
• d2zjrr1 appears in the current release, SCOPe 2.08