Lineage for d2zjrr1 (2zjr R:4-113)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784286Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1784287Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 1784330Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 1784331Species Deinococcus radiodurans [TaxId:1299] [159024] (7 PDB entries)
    Uniprot Q9RXJ1 4-113
  8. 1784332Domain d2zjrr1: 2zjr R:4-113 [154571]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjrr1

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (R:) 50S ribosomal protein L24

SCOPe Domain Sequences for d2zjrr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjrr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]}
psagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkpsmt
npqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkt

SCOPe Domain Coordinates for d2zjrr1:

Click to download the PDB-style file with coordinates for d2zjrr1.
(The format of our PDB-style files is described here.)

Timeline for d2zjrr1: