| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
| Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
| Protein Ribosomal proteins L24 (L24p) [50106] (4 species) |
| Species Deinococcus radiodurans [TaxId:1299] [159024] (7 PDB entries) Uniprot Q9RXJ1 4-113 |
| Domain d2zjrr1: 2zjr R:4-113 [154571] Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1 Representative structure complexed with mg |
PDB Entry: 2zjr (more details), 2.91 Å
SCOPe Domain Sequences for d2zjrr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjrr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]}
psagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkpsmt
npqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkt
Timeline for d2zjrr1:
View in 3DDomains from other chains: (mouse over for more information) d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1 |