Lineage for d2zjrq1 (2zjr Q:2-94)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401024Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 1401025Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 1401026Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 1401027Protein Ribosomal protein L23 [54191] (4 species)
  7. 1401028Species Deinococcus radiodurans [TaxId:1299] [159877] (8 PDB entries)
    Uniprot Q9RXK0 2-94
  8. 1401029Domain d2zjrq1: 2zjr Q:2-94 [154570]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjrq1

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (Q:) 50S ribosomal protein L23

SCOPe Domain Sequences for d2zjrq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjrq1 d.12.1.1 (Q:2-94) Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 1299]}
shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
rkrvgrfigqrndrkkaivrlaegqsiealagq

SCOPe Domain Coordinates for d2zjrq1:

Click to download the PDB-style file with coordinates for d2zjrq1.
(The format of our PDB-style files is described here.)

Timeline for d2zjrq1: