SCOP 1.73: Domain d1c7db_: 1c7d B:

Lineage for d1c7db_ (1c7d B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (22 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (173 PDB entries)

8. Domain d1c7db_: 1c7d B: [15457]
   Other proteins in same PDB: d1c7da1, d1c7da2

Details for d1c7db_

PDB Entry: 1c7d, 1.8 Å

PDB Description: deoxy rhb1.2 (recombinant hemoglobin)

PDB Compounds: (B:) protein (deoxyhemoglobin (beta chain))

SCOP Domain Sequences for d1c7db_:

Sequence; same for both SEQRES and ATOM records:

>d1c7db_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1c7db_:

• d1c7db_ first appeared (with stable ids) in SCOP 1.55
  
• d1c7db_ appears in SCOP 1.71
  
• d1c7db_ appears in SCOP 1.75
  
• d1c7db_ appears in the current release, SCOPe 2.08