SCOPe 2.02: Domain d2zjri1: 2zjr I:4-144

Lineage for d2zjri1 (2zjr I:4-144)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
   core: three turns of irregular (beta-beta-alpha)n superhelix

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L15 (L15p) [52082] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159455] (6 PDB entries)
   Uniprot Q9RSK9 4-144

8. Domain d2zjri1: 2zjr I:4-144 [154562]
   Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
   Representative structure
   complexed with mg

Details for d2zjri1

PDB Entry: 2zjr, 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans

PDB Compounds: (I:) 50S ribosomal protein L15

SCOPe Domain Sequences for d2zjri1:

Sequence; same for both SEQRES and ATOM records:

>d2zjri1 c.12.1.1 (I:4-144) Ribosomal protein L15 (L15p) {Deinococcus radiodurans [TaxId: 1299]}
hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
aasaaaikaveaaggrvvlpe

Timeline for d2zjri1:

• d2zjri1 first appeared in SCOP 1.75
  
• d2zjri1 appears in SCOPe 2.01
  
• d2zjri1 appears in SCOPe 2.03
  
• d2zjri1 appears in the current release, SCOPe 2.08