Lineage for d2zjrh1 (2zjr H:1-134)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397397Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 2397398Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
    automatically mapped to Pfam PF00238
  5. 2397399Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 2397400Protein Ribosomal protein L14 [50195] (5 species)
  7. 2397403Species Deinococcus radiodurans [TaxId:1299] [159079] (6 PDB entries)
    Uniprot Q9RXJ2 1-134
  8. 2397404Domain d2zjrh1: 2zjr H:1-134 [154561]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjrh1

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (H:) 50S ribosomal protein L14

SCOPe Domain Sequences for d2zjrh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjrh1 b.39.1.1 (H:1-134) Ribosomal protein L14 {Deinococcus radiodurans [TaxId: 1299]}
mimpqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaap
rgavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrd
rrfmkivslapevl

SCOPe Domain Coordinates for d2zjrh1:

Click to download the PDB-style file with coordinates for d2zjrh1.
(The format of our PDB-style files is described here.)

Timeline for d2zjrh1: