Lineage for d2zjra2 (2zjr A:33-127)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399426Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 2399430Species Deinococcus radiodurans [TaxId:1299] [159085] (5 PDB entries)
    Uniprot Q9RXJ9 33-127
  8. 2399431Domain d2zjra2: 2zjr A:33-127 [154554]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjra2

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (A:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2zjra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjra2 b.40.4.5 (A:33-127) N-terminal domain of ribosomal protein L2 {Deinococcus radiodurans [TaxId: 1299]}
ltealpktggrnnrgritsrfiggghkrlyriidfkrrdksgvnakvaaieydpnrsari
allhyadgekryilapegltvgatvnagpeaepkl

SCOPe Domain Coordinates for d2zjra2:

Click to download the PDB-style file with coordinates for d2zjra2.
(The format of our PDB-style files is described here.)

Timeline for d2zjra2: