| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) ![]() many known members contain KOW motif |
| Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein) |
| Protein C-terminal domain of ribosomal protein L2 [50115] (5 species) |
| Species Deinococcus radiodurans [TaxId:1299] [159028] (5 PDB entries) Uniprot Q9RXJ9 128-272 |
| Domain d2zjra1: 2zjr A:128-272 [154553] Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1 Representative structure complexed with mg |
PDB Entry: 2zjr (more details), 2.91 Å
SCOPe Domain Sequences for d2zjra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjra1 b.34.5.3 (A:128-272) C-terminal domain of ribosomal protein L2 {Deinococcus radiodurans [TaxId: 1299]}
gnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsgelrrvhs
ecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtgagrvpv
tpwgkptkglktrrkrktsdrfivt
Timeline for d2zjra1:
View in 3DDomains from other chains: (mouse over for more information) d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1 |