Lineage for d2zjr21 (2zjr 2:1-46)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2652055Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 2652056Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 2652057Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 2652058Protein Ribosomal protein L34p [144323] (3 species)
  7. 2652059Species Deinococcus radiodurans [TaxId:1299] [161305] (6 PDB entries)
    Uniprot Q9RSH2 1-46
  8. 2652060Domain d2zjr21: 2zjr 2:1-46 [154550]
    Other proteins in same PDB: d2zjr11, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjr21

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (2:) 50S ribosomal protein L34

SCOPe Domain Sequences for d2zjr21:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjr21 j.118.1.1 (2:1-46) Ribosomal protein L34p {Deinococcus radiodurans [TaxId: 1299]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

SCOPe Domain Coordinates for d2zjr21:

Click to download the PDB-style file with coordinates for d2zjr21.
(The format of our PDB-style files is described here.)

Timeline for d2zjr21: