Lineage for d1c7bb_ (1c7b B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44242Protein Hemoglobin, beta-chain [46500] (16 species)
  7. 44286Species Human (Homo sapiens) [TaxId:9606] [46501] (71 PDB entries)
  8. 44328Domain d1c7bb_: 1c7b B: [15455]
    Other proteins in same PDB: d1c7ba_, d1c7bc_

Details for d1c7bb_

PDB Entry: 1c7b (more details), 1.8 Å

PDB Description: deoxy rhb1.0 (recombinant hemoglobin)

SCOP Domain Sequences for d1c7bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7bb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1c7bb_:

Click to download the PDB-style file with coordinates for d1c7bb_.
(The format of our PDB-style files is described here.)

Timeline for d1c7bb_: