Lineage for d2zjqz1 (2zjq Z:2-59)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893376Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 893528Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 893529Protein Ribosomal protein L32p [144201] (3 species)
  7. 893530Species Deinococcus radiodurans [TaxId:1299] [161178] (10 PDB entries)
    Uniprot P49228 2-59
  8. 893533Domain d2zjqz1: 2zjq Z:2-59 [154548]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1
    automatically matched to 2ZJR Z:2-59

Details for d2zjqz1

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (Z:) 50S ribosomal protein L32

SCOP Domain Sequences for d2zjqz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjqz1 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOP Domain Coordinates for d2zjqz1:

Click to download the PDB-style file with coordinates for d2zjqz1.
(The format of our PDB-style files is described here.)

Timeline for d2zjqz1: