Lineage for d2zjqv1 (2zjq V:1-66)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1718808Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 1718809Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 1718810Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 1718811Species Deinococcus radiodurans [TaxId:1299] [158220] (8 PDB entries)
    Uniprot Q9RXJ4 1-66
  8. 1718816Domain d2zjqv1: 2zjq V:1-66 [154546]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqw1, d2zjqz1
    automatically matched to 2ZJR V:1-66
    protein/RNA complex

Details for d2zjqv1

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (V:) 50S ribosomal protein L29

SCOPe Domain Sequences for d2zjqv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjqv1 a.2.2.1 (V:1-66) Ribosomal protein L29 (L29p) {Deinococcus radiodurans [TaxId: 1299]}
mkpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkael
arkgeq

SCOPe Domain Coordinates for d2zjqv1:

Click to download the PDB-style file with coordinates for d2zjqv1.
(The format of our PDB-style files is described here.)

Timeline for d2zjqv1: