![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) ![]() |
![]() | Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
![]() | Protein Ribosomal protein L29 (L29p) [46563] (5 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [158220] (8 PDB entries) Uniprot Q9RXJ4 1-66 |
![]() | Domain d2zjqv1: 2zjq V:1-66 [154546] Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqw1, d2zjqz1 automatically matched to 2ZJR V:1-66 |
PDB Entry: 2zjq (more details), 3.3 Å
SCOP Domain Sequences for d2zjqv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjqv1 a.2.2.1 (V:1-66) Ribosomal protein L29 (L29p) {Deinococcus radiodurans [TaxId: 1299]} mkpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkael arkgeq
Timeline for d2zjqv1:
![]() Domains from other chains: (mouse over for more information) d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqw1, d2zjqz1 |