SCOPe 2.07: Domain d2zjqt1: 2zjq T:2-85

Lineage for d2zjqt1 (2zjq T:2-85)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families)
   rudiment single hybrid fold with a permuted topology

5. Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
   Pfam PF01016

6. Protein Ribosomal protein L27 [110326] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159323] (7 PDB entries)
   Uniprot Q9RY65 2-85

8. Domain d2zjqt1: 2zjq T:2-85 [154544]
   Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
   automatically matched to 2ZJR T:2-85
   protein/RNA complex

Details for d2zjqt1

PDB Entry: 2zjq, 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit

PDB Compounds: (T:) 50S ribosomal protein L27

SCOPe Domain Sequences for d2zjqt1:

Sequence; same for both SEQRES and ATOM records:

>d2zjqt1 b.84.4.1 (T:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaq

Timeline for d2zjqt1:

• d2zjqt1 first appeared in SCOP 1.75
  
• d2zjqt1 appears in SCOPe 2.06
  
• d2zjqt1 appears in the current release, SCOPe 2.08