Lineage for d2zjqs1 (2zjq S:1-175)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957115Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 957116Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) (S)
  5. 957117Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 957152Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 957153Species Deinococcus radiodurans [TaxId:1299] [159200] (10 PDB entries)
    Uniprot Q9RX88 1-175
  8. 957156Domain d2zjqs1: 2zjq S:1-175 [154543]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
    automatically matched to 2ZJR S:1-175
    protein/RNA complex

Details for d2zjqs1

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (S:) 50S ribosomal protein L25

SCOPe Domain Sequences for d2zjqs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjqs1 b.53.1.1 (S:1-175) Ribosomal protein TL5 (general stress protein CTC) {Deinococcus radiodurans [TaxId: 1299]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlppr

SCOPe Domain Coordinates for d2zjqs1:

Click to download the PDB-style file with coordinates for d2zjqs1.
(The format of our PDB-style files is described here.)

Timeline for d2zjqs1: