SCOP 1.75: Domain d2zjql1: 2zjq L:8-111

Lineage for d2zjql1 (2zjq L:8-111)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (2 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein L18 (L18p) [53139] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159643] (6 PDB entries)
   Uniprot Q9RSL2 8-111

8. Domain d2zjql1: 2zjq L:8-111 [154536]
   Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
   automatically matched to 2ZJR L:8-111

Details for d2zjql1

PDB Entry: 2zjq, 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit

PDB Compounds: (L:) 50S ribosomal protein L18

SCOP Domain Sequences for d2zjql1:

Sequence; same for both SEQRES and ATOM records:

>d2zjql1 c.55.4.1 (L:8-111) Ribosomal protein L18 (L18p) {Deinococcus radiodurans [TaxId: 1299]}
rrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgnktdt
aaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaaregg

Timeline for d2zjql1:

• d2zjql1 is new in SCOP 1.75
  
• d2zjql1 appears in SCOPe 2.01
  
• d2zjql1 appears in the current release, SCOPe 2.08