Lineage for d2zjqk1 (2zjq K:3-115)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050126Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 1050127Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
  5. 1050128Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 1050129Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 1050130Species Deinococcus radiodurans [TaxId:1299] [160268] (6 PDB entries)
    Uniprot Q9RSJ5 3-115
  8. 1050133Domain d2zjqk1: 2zjq K:3-115 [154535]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
    automatically matched to 2ZJR K:3-115
    protein/RNA complex

Details for d2zjqk1

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (K:) 50S ribosomal protein L17

SCOPe Domain Sequences for d2zjqk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjqk1 d.188.1.1 (K:3-115) Prokaryotic ribosomal protein L17 {Deinococcus radiodurans [TaxId: 1299]}
hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmaliel

SCOPe Domain Coordinates for d2zjqk1:

Click to download the PDB-style file with coordinates for d2zjqk1.
(The format of our PDB-style files is described here.)

Timeline for d2zjqk1: