Lineage for d2zjqj1 (2zjq J:6-141)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1902857Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1903099Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 1903164Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein)
    Pfam PF00252
  6. 1903165Protein Ribosomal protein L16p [117889] (4 species)
  7. 1903166Species Deinococcus radiodurans [TaxId:1299] [160196] (6 PDB entries)
    Uniprot Q9RXJ5 5-140
  8. 1903170Domain d2zjqj1: 2zjq J:6-141 [154534]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
    automatically matched to 2ZJR J:6-141
    protein/RNA complex

Details for d2zjqj1

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (J:) 50S ribosomal protein L16

SCOPe Domain Sequences for d2zjqj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjqj1 d.41.4.2 (J:6-141) Ribosomal protein L16p {Deinococcus radiodurans [TaxId: 1299]}
krtkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggki
yirifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghk
lpiqtkmvkrevydea

SCOPe Domain Coordinates for d2zjqj1:

Click to download the PDB-style file with coordinates for d2zjqj1.
(The format of our PDB-style files is described here.)

Timeline for d2zjqj1: