Lineage for d2zjqi1 (2zjq I:4-144)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980515Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 980516Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 980517Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 980518Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 980519Species Deinococcus radiodurans [TaxId:1299] [159455] (6 PDB entries)
    Uniprot Q9RSK9 4-144
  8. 980522Domain d2zjqi1: 2zjq I:4-144 [154533]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
    automatically matched to 2ZJR I:4-144
    protein/RNA complex

Details for d2zjqi1

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (I:) 50S ribosomal protein L15

SCOPe Domain Sequences for d2zjqi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjqi1 c.12.1.1 (I:4-144) Ribosomal protein L15 (L15p) {Deinococcus radiodurans [TaxId: 1299]}
hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
aasaaaikaveaaggrvvlpe

SCOPe Domain Coordinates for d2zjqi1:

Click to download the PDB-style file with coordinates for d2zjqi1.
(The format of our PDB-style files is described here.)

Timeline for d2zjqi1: