SCOP 1.75: Domain d2zjqh1: 2zjq H:1-134

Lineage for d2zjqh1 (2zjq H:1-134)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159079] (6 PDB entries)
   Uniprot Q9RXJ2 1-134

8. Domain d2zjqh1: 2zjq H:1-134 [154532]
   Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
   automatically matched to 2ZJR H:1-134

Details for d2zjqh1

PDB Entry: 2zjq, 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit

PDB Compounds: (H:) 50S ribosomal protein L14

SCOP Domain Sequences for d2zjqh1:

Sequence; same for both SEQRES and ATOM records:

>d2zjqh1 b.39.1.1 (H:1-134) Ribosomal protein L14 {Deinococcus radiodurans [TaxId: 1299]}
mimpqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaap
rgavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrd
rrfmkivslapevl

Timeline for d2zjqh1:

• d2zjqh1 is new in SCOP 1.75
  
• d2zjqh1 appears in SCOPe 2.01
  
• d2zjqh1 appears in the current release, SCOPe 2.08