![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) ![]() |
![]() | Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
![]() | Protein Ribosomal protein L13 [52163] (5 species) synonym: 50S ribosomal protein L13p, HMAL13 |
![]() | Species Deinococcus radiodurans [TaxId:1299] [159475] (6 PDB entries) Uniprot Q9RXY1 30-171 |
![]() | Domain d2zjqg1: 2zjq G:30-171 [154531] Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 automatically matched to 2ZJR G:30-171 |
PDB Entry: 2zjq (more details), 3.3 Å
SCOP Domain Sequences for d2zjqg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjqg1 c.21.1.1 (G:30-171) Ribosomal protein L13 {Deinococcus radiodurans [TaxId: 1299]} ktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqva ltgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrlk vyagethphsaqkpqvlktqpl
Timeline for d2zjqg1:
![]() Domains from other chains: (mouse over for more information) d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 |