Lineage for d2zjqf2 (2zjq F:1-71)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859768Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 859769Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 859770Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 859774Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 859775Species Deinococcus radiodurans [TaxId:1299] [160199] (4 PDB entries)
    Uniprot Q9RSS7 1-71
  8. 859777Domain d2zjqf2: 2zjq F:1-71 [154530]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
    Representative structure

Details for d2zjqf2

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (F:) 50S ribosomal protein L11

SCOP Domain Sequences for d2zjqf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjqf2 d.47.1.1 (F:1-71) Ribosomal protein L11, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
adrsftfitkt

SCOP Domain Coordinates for d2zjqf2:

Click to download the PDB-style file with coordinates for d2zjqf2.
(The format of our PDB-style files is described here.)

Timeline for d2zjqf2: