SCOPe 2.02: Domain d2zjqf1: 2zjq F:72-144

Lineage for d2zjqf1 (2zjq F:72-144)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Deinococcus radiodurans [TaxId:1299] [158348] (4 PDB entries)
   Uniprot Q9RSS7 72-144

8. Domain d2zjqf1: 2zjq F:72-144 [154529]
   Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
   Representative structure
   protein/RNA complex

Details for d2zjqf1

PDB Entry: 2zjq, 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit

PDB Compounds: (F:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2zjqf1:

Sequence; same for both SEQRES and ATOM records:

>d2zjqf1 a.4.7.1 (F:72-144) Ribosomal protein L11, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
ppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsveaaantvagta
rsmgvtveggpna

Timeline for d2zjqf1:

• d2zjqf1 first appeared in SCOP 1.75
  
• d2zjqf1 appears in SCOPe 2.01
  
• d2zjqf1 appears in SCOPe 2.03
  
• d2zjqf1 appears in the current release, SCOPe 2.08