Lineage for d2zjqf1 (2zjq F:72-144)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763169Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 763170Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 763171Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 763224Species Deinococcus radiodurans [TaxId:1299] [158348] (4 PDB entries)
    Uniprot Q9RSS7 72-144
  8. 763226Domain d2zjqf1: 2zjq F:72-144 [154529]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
    Representative structure

Details for d2zjqf1

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (F:) 50S ribosomal protein L11

SCOP Domain Sequences for d2zjqf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjqf1 a.4.7.1 (F:72-144) Ribosomal protein L11, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
ppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsveaaantvagta
rsmgvtveggpna

SCOP Domain Coordinates for d2zjqf1:

Click to download the PDB-style file with coordinates for d2zjqf1.
(The format of our PDB-style files is described here.)

Timeline for d2zjqf1: