Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (6 families) |
Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) |
Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
Species Deinococcus radiodurans [TaxId:1299] [159160] (9 PDB entries) Uniprot Q9RXK2 1-205 |
Domain d2zjqb1: 2zjq B:1-205 [154524] Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 automatically matched to 2ZJR B:1-205 protein/RNA complex |
PDB Entry: 2zjq (more details), 3.3 Å
SCOPe Domain Sequences for d2zjqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjqb1 b.43.3.2 (B:1-205) Ribosomal protein L3 {Deinococcus radiodurans [TaxId: 1299]} mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen lilvkgaipgangglvvlrsaakas
Timeline for d2zjqb1:
View in 3D Domains from other chains: (mouse over for more information) d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 |